CacheBy
Atlas Antibodies Anti-COPRS Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-COPRS Antibody

상품 한눈에 보기

Human COPRS 단백질을 표적으로 하는 rabbit polyclonal 항체. PRMT5 조절 및 분화 자극 관련 연구에 적합. Affinity purification으로 높은 특이성과 재현성 확보. IHC 등 다양한 응용 가능.

카탈로그번호
HPA052552-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA052552-100 Anti-COPRS Antibody, coordinator of PRMT5, differentiation stimulator 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA052552-25 Anti-COPRS Antibody, coordinator of PRMT5, differentiation stimulator 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-COPRS Antibody

Anti-COPRS Antibody

Overview

Coordinator of PRMT5, differentiation stimulator.

  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against Human COPRS.

Alternative Gene Names

  • C17orf79
  • COPR5
  • HSA272196
  • TTP1

Open Datasheet

Target Information

항목 내용
Target Protein Coordinator of PRMT5, differentiation stimulator
Target Gene COPRS
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000031458 (69%)
Rat ENSRNOG00000000111 (66%)

Antigen Sequence:
EAGFATADHSGQERETEKAMDRLARGTQSIPNDSPARGEGTHSEEEGFAMDEEDSDGELNTWELSEGTNCPPKE

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.