Atlas Antibodies Anti-COL6A2 Antibody

상품 한눈에 보기

Human COL6A2 단백질을 인식하는 토끼 폴리클로날 항체. IHC 등 단백질 발현 검증에 적합하며, PrEST 항원을 이용해 친화 정제됨. 인체 반응성이 검증되었으며, 보존제로 sodium azide를 포함함.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA030920-100 Anti-COL6A2 Antibody, collagen, type VI, alpha 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA030920-25 Anti-COL6A2 Antibody, collagen, type VI, alpha 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: collagen, type VI, alpha 2
Supplier: Atlas Antibodies

Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.

Polyclonal antibody against human COL6A2.

항목	내용
Target Protein	collagen, type VI, alpha 2
Target Gene	COL6A2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	TTERNNNCPEKTDCPIHVYFVLDTSESVTMQSPTDILLFHMKQFVPQFISQLQNEFYLDQVALSWRYGGLHFSDQVEVFSPPGSDRASFIKNLQGISSFRRGTFTDCALANMTEQIRQDR
Verified Species Reactivity	Human
Interspecies Identity	Mouse (ENSMUSG00000020241) 89%, Rat (ENSRNOG00000001254) 88%
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.