CacheBy
Atlas Antibodies Anti-COL6A2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-COL6A2 Antibody

상품 한눈에 보기

Human COL6A2 단백질을 표적으로 하는 Rabbit Polyclonal 항체입니다. IHC 등 단백질 발현 검증에 적합하며, PrEST 항원을 이용해 친화 정제되었습니다. 사람에 대한 반응성이 검증되었으며, 최적 조건은 사용자가 설정합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA007029-100 Anti-COL6A2 Antibody, collagen, type VI, alpha 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA007029-25 Anti-COL6A2 Antibody, collagen, type VI, alpha 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-COL6A2 Antibody

Anti-COL6A2 Antibody

Target: collagen, type VI, alpha 2
Supplier: Atlas Antibodies


Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.


Product Description

Polyclonal Antibody against Human COL6A2

Open Datasheet


Target Information

항목 내용
Target Protein collagen, type VI, alpha 2
Target Gene COL6A2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence TTERNNNCPEKTDCPIHVYFVLDTSESVTMQSPTDILLFHMKQFVPQFISQLQNEFYLDQVALSWRYGGLHFSDQVEVFSPPGSDRASFIKNLQGISSFRRGTFTDCALANMTEQIRQDR

Species Reactivity

항목 내용
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000020241 (89%), Rat ENSRNOG00000001254 (88%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Validation
Independent Validation Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.