CacheBy
Atlas Antibodies Anti-COIL Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-COIL Antibody

상품 한눈에 보기

인간 COIL 단백질을 표적으로 하는 폴리클로날 항체입니다. 토끼에서 생산된 IgG 형식으로, PrEST 항원으로 친화 정제되었습니다. 면역세포화학(ICC) 등 다양한 응용에 적합하며, 높은 종간 특이성을 보입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA027885-100 Anti-COIL Antibody, coilin 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA027885-25 Anti-COIL Antibody, coilin 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-COIL Antibody

Anti-COIL Antibody

Target Information

  • Target Protein: Coilin
  • Target Gene: COIL
  • Alternative Gene Names: CLN80, p80-coilin

Product Description

Polyclonal antibody against human COIL.

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Antigen Sequence:
    NRSTDNQRQQQLNDVVKNSSTIIQNPVETPKKDYSLLPLLAAAPQVGEKIAFKLLELTSSYSPDVSDYKEGRILSHNPETQQVDIEILSSLPALREPGKFDLVYHNENGAEVVEYAVTQESKITVFWKELIDPRLIIESPSNTSSTEPA

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000000244 82%
Mouse ENSMUSG00000033983 81%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand
  • Immunocytochemistry (ICC)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

제품 이미지

Recommended Applications - ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.