Atlas Antibodies Anti-COG8 Antibody

상품 한눈에 보기

인간 COG8 단백질을 인식하는 토끼 폴리클로날 항체. PrEST 항원을 이용해 친화 정제됨. IHC 등 다양한 응용에 적합하며, 높은 종 간 보존성을 가짐. 40% 글리세롤 PBS 완충액에 보존제 포함.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA049429-100 Anti-COG8 Antibody, component of oligomeric golgi complex 8 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA049429-25 Anti-COG8 Antibody, component of oligomeric golgi complex 8 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: Component of Oligomeric Golgi Complex 8 (COG8)
Supplier: Atlas Antibodies

Polyclonal antibody against human COG8 protein. Suitable for various research applications including immunohistochemistry (IHC).

DOR1, FLJ22315

Target Protein: Component of Oligomeric Golgi Complex 8
Target Gene: COG8
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
```
AFANYKTFIRGAECTERIHRLFGDVEASLGRLLDRLPSFQQSCRNFVKEAEEISSNRRMNSLTLNRHTEILEILEIPQLMD
```

Highest antigen sequence identity to the following orthologs:

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)