AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-COA7 Antibody
상품 한눈에 보기
인간 COA7 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 Western Blot에 적합합니다. 친화 정제된 Rabbit IgG 항체이며, 높은 종간 반응 특이성을 보입니다. COA7 연구 및 미토콘드리아 단백질 조립 분석에 활용 가능합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA029926-100 Anti-COA7 Antibody, cytochrome c oxidase assembly factor 7 (putative) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA029926-25 Anti-COA7 Antibody, cytochrome c oxidase assembly factor 7 (putative) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-COA7 Antibody
Anti-COA7 Antibody
Target: Cytochrome c oxidase assembly factor 7 (putative)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody against Human COA7.
Alternative Gene Names
C1orf163, FLJ12439, RESA1, SELRC1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Cytochrome c oxidase assembly factor 7 (putative) |
| Target Gene | COA7 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000048351 (88%), Rat ENSRNOG00000010636 (86%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Antigen Sequence
GMVDFQDEEQVKSFLENMEVECNYHCYHEKDPDGCYRLVDYLEGIRKNFDEAAKVLKFNCEENQHSDSCYKLGAYYVTGKGBuffer Composition
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.