CacheBy
Atlas Antibodies Anti-COA7 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-COA7 Antibody

상품 한눈에 보기

Human COA7 단백질을 표적으로 하는 Rabbit Polyclonal 항체. WB와 IHC에 적합하며, PrEST 항원으로 친화 정제됨. 높은 종 간 보존성(마우스 88%, 랫 86%)을 보이며, PBS/glycerol buffer에 보존제 함유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA028154-100 Anti-COA7 Antibody, cytochrome c oxidase assembly factor 7 (putative) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028154-25 Anti-COA7 Antibody, cytochrome c oxidase assembly factor 7 (putative) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-COA7 Antibody

Anti-COA7 Antibody

Target: cytochrome c oxidase assembly factor 7 (putative)

  • IHC (Immunohistochemistry)
  • WB (Western Blot)

Product Description

Polyclonal antibody against Human COA7.

Alternative Gene Names

C1orf163, FLJ12439, RESA1, SELRC1

Open Datasheet

Target Information

항목 내용
Target Protein cytochrome c oxidase assembly factor 7 (putative)
Target Gene COA7
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence GMVDFQDEEQVKSFLENMEVECNYHCYHEKDPDGCYRLVDYLEGIRKNFDEAAKVLKFNCEENQHSDSCYKLGAYYVTGKG
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000048351 (88%), Rat ENSRNOG00000010636 (86%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.