AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CNOT6 Antibody
상품 한눈에 보기
인간 CNOT6 단백질을 인식하는 폴리클로날 항체로, CCR4-NOT 전사 복합체 서브유닛 6을 타깃으로 함. IHC 및 ICC 등 다양한 응용에 적합하며, 친화 정제된 고품질 항체. 토끼 유래 IgG 형식으로 높은 특이성과 재현성을 제공.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA044568-100 Anti-CNOT6 Antibody, CCR4-NOT transcription complex, subunit 6 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA044568-25 Anti-CNOT6 Antibody, CCR4-NOT transcription complex, subunit 6 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CNOT6 Antibody
Anti-CNOT6 Antibody
Target: CCR4-NOT transcription complex, subunit 6
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human CNOT6.
Alternative Gene Names
- CCR4
- Ccr4a
- KIAA1194
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | CCR4-NOT transcription complex, subunit 6 |
| Target Gene | CNOT6 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Homology | Mouse ENSMUSG00000020362 (98%), Rat ENSRNOG00000054891 (88%) |
Antigen Sequence:
RLLNYLLDNLSGTAKRITTEQPPPRSWIMLQEPDRTRPTALFSVMCYN
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.