CacheBy
Atlas Antibodies Anti-CNOT3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CNOT3 Antibody

상품 한눈에 보기

Human CNOT3 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합. Rabbit 유래 IgG 항체이며 PrEST 항원으로 정제됨. 높은 인간 특이성과 라트·마우스 교차 반응성(83%) 확인됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA006408-100 Anti-CNOT3 Antibody, CCR4-NOT transcription complex, subunit 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA006408-25 Anti-CNOT3 Antibody, CCR4-NOT transcription complex, subunit 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CNOT3 Antibody

Anti-CNOT3 Antibody

Target: CCR4-NOT transcription complex, subunit 3
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human CNOT3.


Alternative Gene Names

KIAA0691, LENG2, NOT3, NOT3H

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein CCR4-NOT transcription complex, subunit 3
Target Gene CNOT3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000053234 (83%), Mouse ENSMUSG00000035632 (83%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Antigen Sequence

TPAPYAQAVAPPAPSGPSTTQPRPPSVQPSGGGGGGSGGGGSSSSSNSSAGGGAGKQNGATSYSSVVADSPAEVALSSSGGNNASSQALGPPSGPHNPPPSTSKEPSA


제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.