CacheBy
Atlas Antibodies Anti-PSPH Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PSPH Antibody

상품 한눈에 보기

인간 PSPH 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB 분석에 적합합니다. RNA-seq 데이터 기반의 정교한 orthogonal 검증을 거쳤으며, 토끼에서 생산된 IgG 형 항체입니다. 고순도 Affinity purification 방식으로 제조되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA020376-100 Anti-PSPH Antibody, phosphoserine phosphatase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA020376-25 Anti-PSPH Antibody, phosphoserine phosphatase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PSPH Antibody

Anti-PSPH Antibody

Target: Phosphoserine phosphatase (PSPH)
Supplier: Atlas Antibodies


  • IHC Orthogonal Validation
    Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

  • WB Orthogonal Validation
    Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.


Product Description

Polyclonal Antibody against Human PSPH

Alternative Gene Names

PSP

Open Datasheet


Specifications

항목 내용
Target Protein Phosphoserine phosphatase
Target Gene PSPH
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence AVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAALTERLALIQPSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISG
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000000925 (93%), Mouse ENSMUSG00000029446 (92%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Material Safety Data Sheet


제품 이미지

Enhanced Validation

IHC Orthogonal Validation

WB Orthogonal Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.