Atlas Antibodies Anti-PSPC1 Antibody

상품 한눈에 보기

Human PSPC1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. Orthogonal validation을 통해 단백질 발현이 검증되었으며, 고순도의 affinity purification 방식으로 제조되었습니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA038904-100 Anti-PSPC1 Antibody, paraspeckle component 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA038904-25 Anti-PSPC1 Antibody, paraspeckle component 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: Paraspeckle component 1 (PSPC1)

IHC (Immunohistochemistry)
WB (Western Blot, Orthogonal Validation)
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
ICC (Immunocytochemistry)

Polyclonal antibody against human PSPC1.

FLJ10955, PSP1

항목	내용
Target Protein	Paraspeckle component 1
Target Gene	PSPC1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	PAMGPEGAANMGTPMMPDNGAVHNDRFPQGPPSQMGSPMGSRTGSETPQAPMSGVGPVSGGPGGFGRGSQGGNFEGPNKRRRY
Verified Species Reactivity	Human, Mouse, Rat
Interspecies Information	Mouse ENSMUSG00000021938 (98%), Rat ENSRNOG00000020782 (96%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand