CacheBy
Atlas Antibodies Anti-PRSS12 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PRSS12 Antibody

상품 한눈에 보기

Human PRSS12 단백질을 인식하는 Rabbit Polyclonal Antibody로, IHC 및 ICC에 적합합니다. Recombinant PrEST 항원으로 정제되었으며, 높은 특이성과 재현성을 제공합니다. PBS 기반 버퍼와 sodium azide 보존제를 포함합니다.

카탈로그번호
HPA035055-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA035055-100 Anti-PRSS12 Antibody, protease, serine, 12 (neurotrypsin, motopsin) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035055-25 Anti-PRSS12 Antibody, protease, serine, 12 (neurotrypsin, motopsin) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PRSS12 Antibody

Anti-PRSS12 Antibody

Target Protein: protease, serine, 12 (neurotrypsin, motopsin)

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal Antibody against Human PRSS12

Alternative Gene Names

BSSP-3, MRT1

Open Datasheet

Target Information

항목 내용
Target Protein protease, serine, 12 (neurotrypsin, motopsin)
Target Gene PRSS12
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000015353 (43%), Mouse ENSMUSG00000027978 (42%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

GTVEVYASGVWGTVCSSHWDDSDASVICHQLQLGGKGIAKQTPFSGLGLIPIYWSNVRCRGDEENILLCEKDIWQGGVCPQKMAAAVTCSFS

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.