CacheBy
Atlas Antibodies Anti-PRSS12 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PRSS12 Antibody

상품 한눈에 보기

Human PRSS12 단백질을 인식하는 Rabbit Polyclonal Antibody로, IHC 및 ICC에 적합합니다. Recombinant PrEST 항원으로 정제되었으며, 높은 특이성과 재현성을 제공합니다. PBS 기반 버퍼와 sodium azide 보존제를 포함합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA035055-100 Anti-PRSS12 Antibody, protease, serine, 12 (neurotrypsin, motopsin) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035055-25 Anti-PRSS12 Antibody, protease, serine, 12 (neurotrypsin, motopsin) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PRSS12 Antibody

Anti-PRSS12 Antibody

Target Protein: protease, serine, 12 (neurotrypsin, motopsin)

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal Antibody against Human PRSS12

Alternative Gene Names

BSSP-3, MRT1

Open Datasheet

Target Information

항목 내용
Target Protein protease, serine, 12 (neurotrypsin, motopsin)
Target Gene PRSS12
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000015353 (43%), Mouse ENSMUSG00000027978 (42%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

GTVEVYASGVWGTVCSSHWDDSDASVICHQLQLGGKGIAKQTPFSGLGLIPIYWSNVRCRGDEENILLCEKDIWQGGVCPQKMAAAVTCSFS

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.