CacheBy
Atlas Antibodies Anti-PRSS27 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PRSS27 Antibody

상품 한눈에 보기

Human PRSS27를 인식하는 rabbit polyclonal antibody로, serine protease 27 검출에 적합합니다. Affinity purified 방식으로 제작되었으며, ICC 등 다양한 응용에 사용 가능합니다. Human에 대한 반응성이 검증되었습니다.

카탈로그번호
HPA028848-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA028848-100 Anti-PRSS27 Antibody, serine protease 27 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028848-25 Anti-PRSS27 Antibody, serine protease 27 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PRSS27 Antibody

Anti-PRSS27 Antibody

Target: Serine protease 27 (PRSS27)
Supplier: Atlas Antibodies


  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human PRSS27.


Alternative Gene Names

  • CAPH2
  • MPN

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Serine protease 27
Target Gene PRSS27
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence NTSETSLYQVLLGARQLVQPGPHAMYARVRQVESNPLYQGTASSADVALVELEAPVPFTNYILPVCLPDPSVIFETGMNC
Verified Species Reactivity Human
Interspecies Identity Mouse: 79% (ENSMUSG00000050762) / Rat: 73% (ENSRNOG00000005336)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.