CacheBy
Atlas Antibodies Anti-PRRT4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PRRT4 Antibody

상품 한눈에 보기

PRRT4 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. 인간 PRRT4에 특이적이며, 친화 정제된 고품질 항체입니다. 40% 글리세롤 기반 완충액에 보존되어 장기 보관이 용이합니다.

카탈로그번호
HPA046373-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA046373-100 Anti-PRRT4 Antibody, proline-rich transmembrane protein 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA046373-25 Anti-PRRT4 Antibody, proline-rich transmembrane protein 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PRRT4 Antibody

Anti-PRRT4 Antibody

Target: proline-rich transmembrane protein 4 (PRRT4)
Type: Polyclonal Antibody against Human PRRT4

  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody raised in rabbit against human PRRT4.
Affinity purified using the PrEST antigen as affinity ligand.

Open Datasheet

Target Information

항목 내용
Target Protein proline-rich transmembrane protein 4
Target Gene PRRT4
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence PATTLTPVPQSEASMLSLNLGLNFKFHLRGPAAVWGSPVTETQPLSLGPGQEPGEEVASGLRTDPLWELLVGSSGNSLTEWGS
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000079654 (82%), Rat ENSRNOG00000039388 (81%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.