CacheBy
Atlas Antibodies Anti-PRRX1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PRRX1 Antibody

상품 한눈에 보기

Human PRRX1 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. Affinity purification으로 높은 특이성과 재현성을 제공. ICC 등 다양한 응용에 적합. PHOX1, PMX1 대체 유전자명으로도 사용 가능.

카탈로그번호
HPA063566-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA063566-100 Anti-PRRX1 Antibody, paired related homeobox 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA063566-25 Anti-PRRX1 Antibody, paired related homeobox 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PRRX1 Antibody

Anti-PRRX1 Antibody

Target: paired related homeobox 1 (PRRX1)
Type: Polyclonal Antibody against Human PRRX1

  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody raised in rabbit against the human PRRX1 protein. Provides high specificity and sensitivity for research applications.

Alternative Gene Names

  • PHOX1
  • PMX1

Open Datasheet (PDF)

Target Information

  • Target Protein: paired related homeobox 1
  • Target Gene: PRRX1

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

NERAMLANKNASLLKSYSGDVTAVEQPIVPRPAPRPTDYLSWGTASPYRSSSLPRCCLHE

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat (ENSRNOG00000003720) — 100%
  • Mouse (ENSMUSG00000026586) — 100%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol, PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도와 조건은 사용자가 직접 결정해야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.