CacheBy
Atlas Antibodies Anti-PROZ Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PROZ Antibody

상품 한눈에 보기

Human PROZ 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB 검증을 통해 정확한 단백질 발현 분석 가능. Rabbit 호스트에서 생산되었으며, Affinity purification으로 높은 특이성과 재현성 제공. PBS/glycerol buffer에 보존되어 장기 안정성 확보.

카탈로그번호
HPA052006-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA052006-100 Anti-PROZ Antibody, protein Z, vitamin K-dependent plasma glycoprotein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA052006-25 Anti-PROZ Antibody, protein Z, vitamin K-dependent plasma glycoprotein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PROZ Antibody

Anti-PROZ Antibody

protein Z, vitamin K-dependent plasma glycoprotein


  • Orthogonal validation: 단백질 발현을 IHC로 검증하며, RNA-seq 데이터와 비교하여 고/저 발현 조직 간 차이를 분석
  • Recombinant expression validation: WB에서 표적 단백질 과발현을 이용한 재조합 발현 검증

Product Description

Polyclonal Antibody against Human PROZ


Alternative Gene Names

  • PZ

Open Datasheet


Target Information

항목 내용
Target Protein protein Z, vitamin K-dependent plasma glycoprotein
Target Gene PROZ
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000031445 (63%), Rat ENSRNOG00000019700 (62%)

Antigen Sequence

TPEKDFAEHLLIPRTRGLLSGWARNGTDLGNSLTTRPVTLVEGEECGQVLNVTVTTRTYCERSSVAAMHWMDGSVVTREHRGSWFLTGVLGSQPVGGQAHMVLVTKVSRYS

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 적합한 최적 농도 및 조건은 사용자가 직접 설정해야 합니다.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Tooltip Orthogonal
WB Recombinant Expression
Tooltip Recombinant Expression

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.