CacheBy
Atlas Antibodies Anti-PROX2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PROX2 Antibody

상품 한눈에 보기

Human PROX2 단백질을 인식하는 토끼 폴리클로날 항체로, 면역조직화학 등 다양한 연구 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. 인간 반응성 검증 완료.

카탈로그번호
HPA045057-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA045057-100 Anti-PROX2 Antibody, prospero homeobox 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA045057-25 Anti-PROX2 Antibody, prospero homeobox 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PROX2 Antibody

Anti-PROX2 Antibody

Target Protein: prospero homeobox 2 (PROX2)
Supplier: Atlas Antibodies


Product Description

Polyclonal antibody against human PROX2 protein.

Alternative Gene Names

  • FLJ36749
  • Immunohistochemistry (IHC)

Target Information

항목 내용
Target Protein prospero homeobox 2
Target Gene PROX2
Verified Species Reactivity Human
Interspecies Identity Mouse (60%), Rat (58%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

VLLDPPGHLTQLGRSFQGQVAEGRSEPSPPVGGACKDPLALAALPRRVQLQAGVPVGNLSLAKRLDSPRYPIPPRMTPKPCQDP

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Safety Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

Additional Resources


제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.