CacheBy
Atlas Antibodies Anti-PROSER1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PROSER1 Antibody

상품 한눈에 보기

Human PROSER1 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 응용에 적합합니다. Rabbit 호스트에서 생산되었으며 IgG 아이소타입입니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 반응성(인간, 마우스, 랫트)을 보입니다.

카탈로그번호
HPA055687-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA055687-100 Anti-PROSER1 Antibody, proline and serine rich 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA055687-25 Anti-PROSER1 Antibody, proline and serine rich 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PROSER1 Antibody

Anti-PROSER1 Antibody

Target: Proline and Serine Rich 1 (PROSER1)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human PROSER1.


Alternative Gene Names

bA50D16.2, C13orf23, FLJ12661

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Proline and serine rich 1
Target Gene PROSER1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000049504 (90%), Rat ENSRNOG00000010980 (90%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Antigen Sequence

EQVVDLLRYFSWAEPQLKAMKALQHKMVAVQPTEVVNILNCFTFSKDKLVALELLASNIIDAQNSRPIEDLFRVNMSEKKRCKRILEQAFKGGCKAPHAM


제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.