CacheBy
Atlas Antibodies Anti-PROSC Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PROSC Antibody

상품 한눈에 보기

Human PROSC 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 독립 항체 검증을 통해 단백질 발현이 확인되었습니다. 글리세롤 및 PBS 완충액에 보존됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA023646-100 Anti-PROSC Antibody, proline synthetase co-transcribed homolog (bacterial) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA023646-25 Anti-PROSC Antibody, proline synthetase co-transcribed homolog (bacterial) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PROSC Antibody

Anti-PROSC Antibody

Target: proline synthetase co-transcribed homolog (bacterial)
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry)
  • WB (Western Blot)

Validation:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.


Product Description

Polyclonal Antibody against Human PROSC

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein proline synthetase co-transcribed homolog (bacterial)
Target Gene PROSC
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence VPNLFMLETVDSVKLADKVNSSWQRKGSPERLKVMVQINTSGEESKHGLPPSETIAIVEHINAKCPNLEFVGLMT
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000013751 (88%), Mouse ENSMUSG00000031485 (85%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Independent Validation
Independent Validation Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.