CacheBy
Atlas Antibodies Anti-PRMT7 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PRMT7 Antibody

상품 한눈에 보기

Human PRMT7 단백질에 대한 고특이성 폴리클로날 항체로 IHC 및 ICC 응용에 적합. Rabbit 유래 IgG 형식이며 PrEST 항원으로 친화 정제됨. 다양한 종에서 높은 보존성을 보여 신뢰성 있는 단백질 검출에 활용 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA044241-100 Anti-PRMT7 Antibody, protein arginine methyltransferase 7 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA044241-25 Anti-PRMT7 Antibody, protein arginine methyltransferase 7 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PRMT7 Antibody

Anti-PRMT7 Antibody

Target Protein: Protein Arginine Methyltransferase 7 (PRMT7)

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human PRMT7.

Alternative Gene Names

FLJ10640, KIAA1933

Open Datasheet

Target Information

항목 내용
Target Protein Protein Arginine Methyltransferase 7
Target Gene PRMT7
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat (91%), Mouse (90%)

Antigen Sequence:
PWHNLYFWYVRTAVDQHLGPGAMVMPQAASLHAVVVEFRDLWRIRSPCGDCEGFDVHIMDDMIKRALDFRESREAEPHPLWEYPCRSLSEPWQILTFDFQQPV

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.