CacheBy
Atlas Antibodies Anti-PRMT6 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PRMT6 Antibody

상품 한눈에 보기

Human PRMT6 단백질을 인식하는 폴리클로날 토끼 항체로, IHC 및 ICC 실험에 적합합니다. PrEST 항원을 이용한 친화 정제 방식으로 고순도 확보. 인간 반응성 검증 완료. 글리세롤 및 PBS 버퍼에 안정화되어 장기 보관 가능.

카탈로그번호
HPA059424-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA059424-100 Anti-PRMT6 Antibody, protein arginine methyltransferase 6 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA059424-25 Anti-PRMT6 Antibody, protein arginine methyltransferase 6 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PRMT6 Antibody

Anti-PRMT6 Antibody

Target Protein: protein arginine methyltransferase 6 (PRMT6)

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human PRMT6.

Alternative Gene Names

FLJ10559, HRMT1L6

Open Datasheet (PDF)

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    WKQALLYLNEPVQVEQDTDVSGEITLLPSRDNPRRLRVLLRYKVGDQEEKTKDFAME

Verified Species Reactivity

Human

Interspecies Information

Species Ortholog ID Sequence Identity
Rat ENSRNOG00000048996 95%
Mouse ENSMUSG00000049300 91%

Antibody Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.