
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-PPP1R1C Antibody
상품 한눈에 보기
인간 PPP1R1C 단백질에 대한 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식입니다. PrEST 항원을 이용해 친화 정제되었으며, ICC 등 다양한 응용에 적합합니다. Human에 반응하며, 안정적인 PBS/glycerol 버퍼로 보존됩니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA055043-100 Anti-PPP1R1C Antibody, protein phosphatase 1, regulatory (inhibitor) subunit 1C 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA055043-25 Anti-PPP1R1C Antibody, protein phosphatase 1, regulatory (inhibitor) subunit 1C 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-PPP1R1C Antibody
Anti-PPP1R1C Antibody
Target: protein phosphatase 1, regulatory (inhibitor) subunit 1C
Supplier: Atlas Antibodies
Recommended Applications
면역세포화학 (ICC) 등 다양한 연구 응용에 적합
Product Description
Polyclonal Antibody against Human PPP1R1C
Alternative Gene Names
Inhibitor-1-like
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | protein phosphatase 1, regulatory (inhibitor) subunit 1C |
| Target Gene | PPP1R1C |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000024990 (84%), Mouse ENSMUSG00000034683 (82%) |
Antigen Sequence:
PASLVILNEHNPPEIDDKRGPNTQGELQNASPKQRKQSVYTPPTI
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 최적 농도 및 조건은 실험 목적에 따라 사용자가 직접 결정해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



