CacheBy
Atlas Antibodies Anti-PPP1R35 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-PPP1R35 Antibody

상품 한눈에 보기

Human PPP1R35 단백질을 표적으로 하는 토끼 폴리클로날 항체로, 단백질 인산화효소 조절 연구에 적합. ICC 등 다양한 응용 가능. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA021604-100 Anti-PPP1R35 Antibody, protein phosphatase 1, regulatory subunit 35 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA021604-25 Anti-PPP1R35 Antibody, protein phosphatase 1, regulatory subunit 35 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-PPP1R35 Antibody

Anti-PPP1R35 Antibody

Target: protein phosphatase 1, regulatory subunit 35 (PPP1R35)
Type: Polyclonal Antibody against Human PPP1R35


  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody raised in rabbit against human PPP1R35, a regulatory subunit of protein phosphatase 1.

Alternative Gene Names: C7orf47, MGC22793
Open Datasheet (PDF)


Target Information

항목 내용
Target Protein protein phosphatase 1, regulatory subunit 35
Target Gene PPP1R35
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence NAALREKLALLPPQARAPHPKEPPGPGPDMTILCDPETLFYESPHLTLDGLPPLRLQLRPRPSEDTFLMHRTLRRWEA
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000050881 (82%), Mouse ENSMUSG00000029725 (81%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Recommended Applications - ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.