
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CLCC1 Antibody
상품 한눈에 보기
인간 CLCC1 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 ICC에 적합하며, PrEST 항원을 이용해 친화 정제됨. 인간에 대한 검증 완료, 쥐 및 생쥐와 부분적 교차 반응성 있음. 40% 글리세롤 기반 PBS 버퍼에 보존제 포함.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA009087-100 Anti-CLCC1 Antibody, chloride channel CLIC-like 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA009087-25 Anti-CLCC1 Antibody, chloride channel CLIC-like 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CLCC1 Antibody
Anti-CLCC1 Antibody
Target: Chloride channel CLIC-like 1 (CLCC1)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC), independently validated by comparing antibodies targeting different epitopes
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human CLCC1.
Alternative Gene Names
- MCLC
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Chloride channel CLIC-like 1 |
| Target Gene | CLCC1 |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | PPQALRPRDRRRQEEIDYRPDGGAGDADFHYRGQMGPTEQGPYAKTYEGRREILRERDVDLRFQTGNKSPEVLRAFDVPDAEAREHPTVVPSHKSPVLDTKPKE |
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000020360 | 64% |
| Mouse | ENSMUSG00000027884 | 62% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



