CacheBy
Atlas Antibodies Anti-CLCC1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CLCC1 Antibody

상품 한눈에 보기

인간 CLCC1 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 ICC에 적합하며, PrEST 항원을 이용해 친화 정제됨. 인간에 대한 검증 완료, 쥐 및 생쥐와 부분적 교차 반응성 있음. 40% 글리세롤 기반 PBS 버퍼에 보존제 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA009087-100 Anti-CLCC1 Antibody, chloride channel CLIC-like 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA009087-25 Anti-CLCC1 Antibody, chloride channel CLIC-like 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CLCC1 Antibody

Anti-CLCC1 Antibody

Target: Chloride channel CLIC-like 1 (CLCC1)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC), independently validated by comparing antibodies targeting different epitopes
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human CLCC1.


Alternative Gene Names

  • MCLC

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Chloride channel CLIC-like 1
Target Gene CLCC1
Antigen Sequence Type Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence PPQALRPRDRRRQEEIDYRPDGGAGDADFHYRGQMGPTEQGPYAKTYEGRREILRERDVDLRFQTGNKSPEVLRAFDVPDAEAREHPTVVPSHKSPVLDTKPKE

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000020360 64%
Mouse ENSMUSG00000027884 62%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent Validation
Independent Validation Tooltip
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.