
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CLC Antibody
상품 한눈에 보기
Human CLC(Charcot-Leyden crystal galectin)에 대한 고품질 폴리클로날 항체. IHC 및 WB에 적합하며 RNA-seq 데이터 기반 Orthogonal Validation 수행. Rabbit 유래 IgG, PrEST 항원으로 Affinity 정제. 인체 반응성 검증 완료.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA041751-100 Anti-CLC Antibody, Charcot-Leyden crystal galectin 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041751-25 Anti-CLC Antibody, Charcot-Leyden crystal galectin 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CLC Antibody
Anti-CLC Antibody
Charcot-Leyden crystal galectin
Recommended Applications
- IHC (Orthogonal Validation)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues. - WB (Western Blot)
Product Description
Polyclonal Antibody against Human CLC
Alternative Gene Names
Gal-10, LGALS10, MGC149659
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Charcot-Leyden crystal galectin |
| Target Gene | CLC |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | LACFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVESKNMPFQDGQEFELSISVLPDKYQVM |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000012681 (33%), Mouse ENSMUSG00000053964 (32%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



