CacheBy
Atlas Antibodies Anti-CLC Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CLC Antibody

상품 한눈에 보기

Human CLC(Charcot-Leyden crystal galectin)에 대한 고품질 폴리클로날 항체. IHC 및 WB에 적합하며 RNA-seq 데이터 기반 Orthogonal Validation 수행. Rabbit 유래 IgG, PrEST 항원으로 Affinity 정제. 인체 반응성 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA041751-100 Anti-CLC Antibody, Charcot-Leyden crystal galectin 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041751-25 Anti-CLC Antibody, Charcot-Leyden crystal galectin 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CLC Antibody

Anti-CLC Antibody

Charcot-Leyden crystal galectin


  • IHC (Orthogonal Validation)
    Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB (Western Blot)

Product Description

Polyclonal Antibody against Human CLC


Alternative Gene Names

Gal-10, LGALS10, MGC149659

Open Datasheet


Target Information

항목 내용
Target Protein Charcot-Leyden crystal galectin
Target Gene CLC
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence LACFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVESKNMPFQDGQEFELSISVLPDKYQVM
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000012681 (33%), Mouse ENSMUSG00000053964 (32%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip
WB

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.