Atlas Antibodies Anti-CIART Antibody

상품 한눈에 보기

인간 CIART 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 WB 응용에 적합. Rabbit에서 생산되었으며 PrEST 항원으로 정제됨. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증된 고신뢰 제품.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA054349-100 Anti-CIART Antibody, circadian associated repressor of transcription 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA054349-25 Anti-CIART Antibody, circadian associated repressor of transcription 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-CIART Antibody

Anti-CIART Antibody

Target: Circadian associated repressor of transcription (CIART)
Supplier: Atlas Antibodies

Recommended Applications

Immunohistochemistry (IHC)
Western Blot (WB)

Orthogonal validation:
Protein expression verified using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal antibody against human CIART.

Alternative Gene Names: BC017397, C1orf51
Target Protein: Circadian associated repressor of transcription
Target Gene: CIART
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

NTQGCTTEGDLLFAQKCKELQGFIPPLTDLLNGLKMGRFERGLSSFQQSVAMDRIQRIVGVLQKPQMGERYLGTLLQVEGMLKTWFPQ

Verified Species Reactivity

Human

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000038550 (97%)
Rat ENSRNOG00000042717 (95%)

Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen as affinity ligand