
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CIAPIN1 Antibody
상품 한눈에 보기
Human CIAPIN1 단백질을 인식하는 폴리클로날 토끼 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. Orthogonal validation으로 RNA-seq 데이터와 비교 검증된 신뢰성 높은 항체입니다. Affinity purification으로 높은 특이성과 순도를 제공합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA041350-100 Anti-CIAPIN1 Antibody, cytokine induced apoptosis inhibitor 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041350-25 Anti-CIAPIN1 Antibody, cytokine induced apoptosis inhibitor 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CIAPIN1 Antibody
Anti-CIAPIN1 Antibody
Target Protein: cytokine induced apoptosis inhibitor 1
Alternative Gene Name: Anamorsin
Recommended Applications
- IHC (Immunohistochemistry) – Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues
- WB (Western Blot)
- ICC (Immunocytochemistry)
Product Description
Polyclonal Antibody against Human CIAPIN1
Specifications
| 항목 | 내용 |
|---|---|
| Target Gene | CIAPIN1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | FGISAGQFVAVVWDKSSPVEALKGLVDKLQALTGNEGRVSVENIKQLLQSAHKESSFDIILSGLVPGSTTLHSAEILAEIARILRPGGCL |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (78%), Rat (76%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. |
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



