
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CFAP77 Antibody
상품 한눈에 보기
Human CFAP77 단백질을 인식하는 토끼 폴리클로날 항체로, IHC와 WB(재조합 발현) 검증 완료. C9orf171, FLJ46082 유전자 대체명 포함. PrEST 항원 기반 친화 정제, 인간 반응성 확인. 글리세롤/PBS 버퍼에 보존제 포함.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA061069-100 Anti-CFAP77 Antibody, cilia and flagella associated protein 77 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA061069-25 Anti-CFAP77 Antibody, cilia and flagella associated protein 77 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CFAP77 Antibody
Anti-CFAP77 Antibody
Target: cilia and flagella associated protein 77 (CFAP77)
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, Recombinant Expression Validation)
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal Antibody against Human CFAP77
Alternative Gene Names
- C9orf171
- FLJ46082
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | cilia and flagella associated protein 77 |
| Target Gene | CFAP77 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | EKKQKVVLGKLYETRSSQLRKYKPPVKLDTLWHMPHFQKVGRHLDTFPTEADRQRALKAHREECAVRQGTLRMGNYTH |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000079502 (90%), Rat ENSRNOG00000028805 (88%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer Composition | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



