CacheBy
Atlas Antibodies Anti-CFAP77 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CFAP77 Antibody

상품 한눈에 보기

Human CFAP77 단백질을 인식하는 토끼 폴리클로날 항체로, IHC와 WB(재조합 발현) 검증 완료. C9orf171, FLJ46082 유전자 대체명 포함. PrEST 항원 기반 친화 정제, 인간 반응성 확인. 글리세롤/PBS 버퍼에 보존제 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA061069-100 Anti-CFAP77 Antibody, cilia and flagella associated protein 77 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA061069-25 Anti-CFAP77 Antibody, cilia and flagella associated protein 77 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CFAP77 Antibody

Anti-CFAP77 Antibody

Target: cilia and flagella associated protein 77 (CFAP77)

  • IHC (Immunohistochemistry)
  • WB (Western Blot, Recombinant Expression Validation)
    Recombinant expression validation in WB using target protein overexpression.

Product Description

Polyclonal Antibody against Human CFAP77

Alternative Gene Names

  • C9orf171
  • FLJ46082

Open Datasheet

Target Information

항목 내용
Target Protein cilia and flagella associated protein 77
Target Gene CFAP77
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence EKKQKVVLGKLYETRSSQLRKYKPPVKLDTLWHMPHFQKVGRHLDTFPTEADRQRALKAHREECAVRQGTLRMGNYTH
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000079502 (90%), Rat ENSRNOG00000028805 (88%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer Composition 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Recombinant Expression
Recombinant Expression Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.