CacheBy
Atlas Antibodies Anti-CFAP91 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CFAP91 Antibody

상품 한눈에 보기

Atlas Antibodies의 Anti-CFAP91 항체는 인간 CFAP91 단백질을 인식하는 고품질 폴리클로날 항체입니다. IHC 및 RNA-seq 데이터 기반 정교한 Orthogonal 검증을 통해 단백질 발현을 확인합니다. Rabbit 호스트, IgG 아이소타입이며 PrEST 항원을 이용해 친화정제되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA074084-100 Anti-CFAP91 Antibody, MYCBP associated and testis expressed 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA074084-25 Anti-CFAP91 Antibody, MYCBP associated and testis expressed 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CFAP91 Antibody

Anti-CFAP91 Antibody

MYCBP associated and testis expressed 1

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human CFAP91

Alternative Gene Names

AAT1, AAT1alpha, C3orf15, CaM-IP2, SPATA26, MAATS1

Open Datasheet

Target Information

항목 내용
Target Protein MYCBP associated and testis expressed 1
Target Gene CFAP91
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000022805 (83%), Rat ENSRNOG00000002976 (81%)

Antigen Sequence

DFLSKELVRLQEERRIHAFVMLAERQRRVREAEESGRRQVEKQRLREEDEIFKEVVKVHHSTISSYLEDIILNTEANT

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.