CacheBy
Atlas Antibodies Anti-CEP95 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CEP95 Antibody

상품 한눈에 보기

Human CEP95 단백질을 인식하는 rabbit polyclonal 항체로, IHC 및 WB에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. CEP95 연구 및 세포 중심체 단백질 분석에 유용합니다.

카탈로그번호
HPA052428-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA052428-100 Anti-CEP95 Antibody, centrosomal protein 95kDa 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA052428-25 Anti-CEP95 Antibody, centrosomal protein 95kDa 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CEP95 Antibody

Anti-CEP95 Antibody

Target: Centrosomal protein 95 kDa (CEP95)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human CEP95.


Alternative Gene Names

  • CCDC45
  • DKFZp667E1824

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Centrosomal protein 95 kDa
Target Gene CEP95
Antigen Sequence Type Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence ALRRHDLLTTLVKKEYEHNKRLQDFKDCIRRQRLTQSKIKENRQQIVRARKYYDDYRVQLCAKMMRMRTREEMIFKKLFEEGLNIQKQRLRDLRNYAKEKRDEQRRRHQDELDSM

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000018372 87%
Rat ENSRNOG00000014354 87%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.