CacheBy
Atlas Antibodies Anti-CEP83 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CEP83 Antibody

상품 한눈에 보기

Human CEP83 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC 응용에 적합합니다. Affinity purification으로 높은 특이성과 재현성을 제공합니다. CCDC41/NY-REN-58 유전자 타깃에 사용됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA038161-100 Anti-CEP83 Antibody, centrosomal protein 83kDa 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038161-25 Anti-CEP83 Antibody, centrosomal protein 83kDa 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CEP83 Antibody

Anti-CEP83 Antibody

Target Information

  • Target Protein: Centrosomal protein 83kDa
  • Target Gene: CEP83
  • Alternative Gene Names: CCDC41, NY-REN-58

Product Description

Polyclonal antibody against human CEP83.
Recommended for immunohistochemistry (IHC) and immunocytochemistry (ICC) applications.

Antigen Information

  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    LKRLQEKVEVLEAKKEELETENQVLNRQNVPFEDYTRLQKRLKDIQRRHNEFRSLILVPNMPPTASINPVSFQSSAMVPSMELPFPPHMQEEQHQRELSL
  • Verified Species Reactivity: Human
  • Interspecies Information:
    • Rat ENSRNOG00000007859 (90%)
    • Mouse ENSMUSG00000020024 (89%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet
Open Datasheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.