
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CEACAM19 Antibody
상품 한눈에 보기
Human CEACAM19 단백질을 인식하는 rabbit polyclonal 항체로, 면역조직화학(IHC) 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제됨. 인간에 대해 검증되었으며, 40% glycerol 및 PBS buffer에 보존제 함유.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA052865-100 Anti-CEACAM19 Antibody, carcinoembryonic antigen-related cell adhesion molecule 19 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA052865-25 Anti-CEACAM19 Antibody, carcinoembryonic antigen-related cell adhesion molecule 19 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CEACAM19 Antibody
Anti-CEACAM19 Antibody
Target: carcinoembryonic antigen-related cell adhesion molecule 19 (CEACAM19)
Supplier: Atlas Antibodies
Recommended Applications
면역조직화학 (IHC)
Product Description
Polyclonal antibody against human CEACAM19.
Alternative Gene Names
- CEAL1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | carcinoembryonic antigen-related cell adhesion molecule 19 |
| Target Gene | CEACAM19 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | TRNWRGQSHRLPAPRGQGSLSILCSAVSPVPSVTPSTWMATTEKPELGPAHDAGDNNIYEVMPSPVLLVSPISDTRSINPARPLPTPPHLQAEPENHQYQQDLLNPDPA |
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
| Species | Gene ID | Identity |
|---|---|---|
| Rat | ENSRNOG00000043088 | 38% |
| Mouse | ENSMUSG00000049848 | 37% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet (Sodium Azide)
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야에 대한 최적의 농도와 조건은 사용자가 결정해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



