Atlas Antibodies Anti-CEACAM1 Antibody
| 상품 옵션 정보 | ||||||||
|---|---|---|---|---|---|---|---|---|
| 카탈로그 번호 | CAS 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
| HPA011041-100 | - | Atlas Antibodies HPA011041-100 Anti-CEACAM1 Antibody, carcinoembryonic antigen-related cell adhesion molecule 1 (biliary glycoprotein) 100ul | 재고문의 | 100ul | 728,000원 | - | 800,800원 | |
| HPA011041-25 | - | Atlas Antibodies HPA011041-25 Anti-CEACAM1 Antibody, carcinoembryonic antigen-related cell adhesion molecule 1 (biliary glycoprotein) 25ul | 재고문의 | 25ul | 528,000원 | - | 580,800원 | |
다른 상품 둘러보기
Anti-CEACAM1 Antibody
carcinoembryonic antigen-related cell adhesion molecule 1 (biliary glycoprotein)
Recommended Applications
Product Description
Polyclonal Antibody against Human CEACAM1
Alternative Gene Names
BGP, BGP1, CD66a
Target Protein
carcinoembryonic antigen-related cell adhesion molecule 1 (biliary glycoprotein)
Target Gene
CEACAM1
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Copy sequence to clipboard
NVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQE
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
Rat ENSRNOG00000027607 (48%)
Mouse ENSMUSG00000053228 (48%)
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. [Material Safety Data Sheet](https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf Material Safety Data Sheet)
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제 방법 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|