
원본
Thermo Fisher Scientific Gm6185 Polyclonal Antibody
상품 한눈에 보기
Thermo Fisher Scientific Gm6185 Polyclonal Antibody는 Mouse 단백질을 인식하는 Rabbit IgG 기반 항체입니다. Western blot에 적합하며, 합성 펩타이드 면역원으로 제작되었습니다. 액상 형태로 제공되며, -20°C에서 보관 시 안정적입니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 04. 오후 06:30
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA568697 Gm6185 Polyclonal Antibody 100 ul pk판매 단위 pk ·
재고 확인 필요
642,300원VAT 포함 706,530원
Thermo Fisher Scientific · Thermo Fisher Scientific Gm6185 Polyclonal Antibody
Applications
- Western Blot (WB)
Tested Dilution: 1.0 µg/mL
Publications: -
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide directed towards the middle region of mouse Gm6185 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.5–1.0 mg/mL |
| Purification | Affinity chromatography |
| Storage Buffer | PBS with 2% sucrose |
| Contains | 0.09% sodium azide |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Wet ice |
| RRID | AB_2690020 |
Product Specific Information
This target displays homology in the following species:
- Cow: 79%
- Dog: 86%
- Guinea Pig: 92%
- Horse: 93%
- Human: 100%
- Rabbit: 92%
- Rat: 93%
Peptide sequence: MYSITKGYVKSQEDAKLLIRQISGRESIYRKLYDILEKNKREAIRELGLI
For short-term use, store at 2–8°C up to 1 week.
For long-term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
Concentration is batch dependent: 0.5–1 mg/mL
Target Information
Gm6185 is a protein coding gene.
Note: For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.
