CacheBy
Thermo Fisher Scientific Gm6185 Polyclonal Antibody
원본

Thermo Fisher Scientific Gm6185 Polyclonal Antibody

상품 한눈에 보기

Thermo Fisher Scientific Gm6185 Polyclonal Antibody는 Mouse 단백질을 인식하는 Rabbit IgG 기반 항체입니다. Western blot에 적합하며, 합성 펩타이드 면역원으로 제작되었습니다. 액상 형태로 제공되며, -20°C에서 보관 시 안정적입니다.

판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 04. 오후 06:30
Thermo Fisher Scientific PA568697 Gm6185 Polyclonal Antibody 100 ul pk판매 단위 pk ·
재고 확인 필요
642,300원VAT 포함 706,530원

Thermo Fisher Scientific · Thermo Fisher Scientific Gm6185 Polyclonal Antibody

Applications

  • Western Blot (WB)

Tested Dilution: 1.0 µg/mL
Publications: -


Product Specifications

항목 내용
Species Reactivity Mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen Synthetic peptide directed towards the middle region of mouse Gm6185
Conjugate Unconjugated
Form Liquid
Concentration 0.5–1.0 mg/mL
Purification Affinity chromatography
Storage Buffer PBS with 2% sucrose
Contains 0.09% sodium azide
Storage Conditions -20°C, Avoid Freeze/Thaw Cycles
Shipping Conditions Wet ice
RRID AB_2690020

Product Specific Information

This target displays homology in the following species:

  • Cow: 79%
  • Dog: 86%
  • Guinea Pig: 92%
  • Horse: 93%
  • Human: 100%
  • Rabbit: 92%
  • Rat: 93%

Peptide sequence: MYSITKGYVKSQEDAKLLIRQISGRESIYRKLYDILEKNKREAIRELGLI

For short-term use, store at 2–8°C up to 1 week.
For long-term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
Concentration is batch dependent: 0.5–1 mg/mL


Target Information

Gm6185 is a protein coding gene.

Note: For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.