Atlas Antibodies Anti-CDSN Antibody

상품 한눈에 보기

인체 CDSN 단백질을 인식하는 폴리클로날 항체로, IHC 분석 및 단백질 발현 정량에 적합. Rabbit 유래 IgG 형식이며, PrEST 항원으로 친화 정제됨. RNA-seq 기반 직교 검증으로 신뢰성 높은 결과 제공.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA044730-100 Anti-CDSN Antibody, corneodesmosin 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA044730-25 Anti-CDSN Antibody, corneodesmosin 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: corneodesmosin
Recommended Applications: IHC (Orthogonal validation)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Polyclonal antibody against human CDSN.

항목	내용
Target Protein	corneodesmosin
Target Gene	CDSN
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	SALPTNDNSYRGILNPSQPGQSSSSSQTFGVSSSGQSVSSNQRPCSSDIPDSPCSGGPIVSHSGPYIPSSHSVSGGQRPVVVVVDQHGSGAPG
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000039518 (61%), Rat ENSRNOG00000005934 (31%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.