CacheBy
Atlas Antibodies Anti-CDSN Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CDSN Antibody

상품 한눈에 보기

인체 CDSN 단백질을 인식하는 폴리클로날 항체로, IHC Orthogonal 검증 완료. Rabbit 유래 IgG로 제작되었으며, PrEST 항원을 이용해 친화 정제됨. Human에 반응하며, corneodesmosin 연구용으로 적합.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA054184-100 Anti-CDSN Antibody, corneodesmosin 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA054184-25 Anti-CDSN Antibody, corneodesmosin 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CDSN Antibody

Anti-CDSN Antibody

Target Protein: corneodesmosin

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human CDSN

Alternative Gene Names

D6S586E

Open Datasheet

Target Information

항목 내용
Target Protein corneodesmosin
Target Gene CDSN
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence SALPTNDNSYRGILNPSQPGQSSSSSQTFGVSSSGQSVSSNQRPCSSDIPDSPCSGGPIVSHSGPYIPSSHSVSGGQRPVVVVVDQHGSGAPG

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

유전자 ID 항원 서열 일치율
Mouse ENSMUSG00000039518 61%
Rat ENSRNOG00000005934 31%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.