CacheBy
Atlas Antibodies Anti-CD93 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CD93 Antibody

상품 한눈에 보기

인간 CD93 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. 정제된 PrEST 항원을 이용해 친화 정제되었으며, RNA-seq 및 재조합 발현 검증을 통해 높은 특이성을 보장합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA012368-100 Anti-CD93 Antibody, CD93 molecule 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA012368-25 Anti-CD93 Antibody, CD93 molecule 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CD93 Antibody

Anti-CD93 Antibody

Target Information

  • Target Protein: CD93 molecule
  • Target Gene: CD93
  • Alternative Gene Names: C1qR(P), C1QR1, C1qRP, CDw93, dJ737E23.1, ECSM3, MXRA4

Product Description

Polyclonal Antibody against Human CD93

  • IHC (Orthogonal Validation): Validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB (Recombinant Expression): Validation in Western Blot using target protein overexpression.
  • ICC: Immunocytochemistry application supported.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

FNTQGSFHCGCLPGWVLAPNGVSCTMGPVSLGPPSGPPDEEDKGEKEGSTVPRAATASPTRGPEGTPKATPTTSRPSLSSDAPITSAPLKMLAPSGSSGVWREPSIHHATAASGPQEPAGGDSSVATQNNDGTDGQKL

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Mouse ENSMUSG00000027435 41%
Rat ENSRNOG00000060269 29%

Antibody Properties

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip
WB Recombinant Expression
Recombinant Expression Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.