CacheBy
Atlas Antibodies Anti-CD99L2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CD99L2 Antibody

상품 한눈에 보기

Human CD99L2 단백질을 인식하는 폴리클로나 항체로, IHC 및 RNA-seq 데이터 비교를 통한 Orthogonal 검증 완료. Rabbit 호스트 기반 IgG 항체이며, PrEST 항원으로 친화 정제됨. 인체 시료에 높은 특이성과 재현성을 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA038783-100 Anti-CD99L2 Antibody, CD99 molecule-like 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038783-25 Anti-CD99L2 Antibody, CD99 molecule-like 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CD99L2 Antibody

Anti-CD99L2 Antibody

CD99 molecule-like 2

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human CD99L2.

Alternative Gene Names

CD99B, MIC2L1

Open Datasheet

Target Information

항목 내용
Target Protein CD99 molecule-like 2
Target Gene CD99L2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000035776 (72%), Rat ENSRNOG00000024953 (70%)

Antigen Sequence

DDRNDRDDGRRKPIAGGGGFSDKDLEDIVGGGEYKPDKGKGDGRYGSNDDPGSGMVAEP

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.