CacheBy
Atlas Antibodies Anti-CCS Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CCS Antibody

상품 한눈에 보기

Human CCS 단백질을 인식하는 폴리클로날 항체로, superoxide dismutase의 copper chaperone 연구에 적합. Rabbit 유래 IgG 항체이며, Affinity Purified 방식으로 정제됨. IHC 등 다양한 응용에 사용 가능. PBS/glycerol buffer에 보존됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA040026-100 Anti-CCS Antibody, copper chaperone for superoxide dismutase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040026-25 Anti-CCS Antibody, copper chaperone for superoxide dismutase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CCS Antibody

Anti-CCS Antibody

Target: Copper chaperone for superoxide dismutase (CCS)
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC) 등 다양한 연구용 응용 가능

Product Description

Polyclonal antibody against human CCS protein.

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein Copper chaperone for superoxide dismutase
Target Gene CCS
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse (81%), Rat (79%)

Antigen Sequence:
SDSGNQGTLCTLEFAVQMTCQSCVDAVRKSLQGVAGVQDVEVHLEDQMVLVHTTLPSQEVQALLEGTGRQAVLKGMGS

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용에 대한 최적의 농도와 조건은 사용자가 직접 결정해야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.