
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CCR7 Antibody
상품 한눈에 보기
Human CCR7 단백질을 인식하는 Rabbit Polyclonal Antibody로, 면역세포 이동 관련 연구에 적합. PrEST 항원으로 친화 정제됨. Human에 검증되었으며 Mouse 및 Rat과 높은 서열 유사성 보유. PBS+글리세롤 버퍼에 보존제 포함.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA031383-100 Anti-CCR7 Antibody, chemokine (C-C motif) receptor 7 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031383-25 Anti-CCR7 Antibody, chemokine (C-C motif) receptor 7 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CCR7 Antibody
Anti-CCR7 Antibody
Target Information
- Target Protein: chemokine (C-C motif) receptor 7
- Target Gene: CCR7
- Alternative Gene Names: BLR2, CD197, CDw197, CMKBR7, EBI1
Product Description
Polyclonal Antibody against Human CCR7.
Recommended Applications
Immunocytochemistry (ICC)
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Antigen Sequence:
GVKFRNDLFKLFKDLGCLSQEQLRQWSSCRHIRRSSMSVEAETTTTFS
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000010665 (85%)
- Mouse ENSMUSG00000037944 (83%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



