CacheBy
Atlas Antibodies Anti-CCR7 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CCR7 Antibody

상품 한눈에 보기

Human CCR7 단백질을 인식하는 Rabbit Polyclonal Antibody로, 면역세포 이동 관련 연구에 적합. PrEST 항원으로 친화 정제됨. Human에 검증되었으며 Mouse 및 Rat과 높은 서열 유사성 보유. PBS+글리세롤 버퍼에 보존제 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA031383-100 Anti-CCR7 Antibody, chemokine (C-C motif) receptor 7 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031383-25 Anti-CCR7 Antibody, chemokine (C-C motif) receptor 7 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CCR7 Antibody

Anti-CCR7 Antibody

Target Information

  • Target Protein: chemokine (C-C motif) receptor 7
  • Target Gene: CCR7
  • Alternative Gene Names: BLR2, CD197, CDw197, CMKBR7, EBI1

Product Description

Polyclonal Antibody against Human CCR7.

Immunocytochemistry (ICC)

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Antigen Sequence:
    GVKFRNDLFKLFKDLGCLSQEQLRQWSSCRHIRRSSMSVEAETTTTFS

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000010665 (85%)
  • Mouse ENSMUSG00000037944 (83%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Open Datasheet

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.