
원본
Thermo Fisher Scientific CK1 alpha Polyclonal Antibody
상품 한눈에 보기
CK1 alpha 단백질을 인식하는 Rabbit Polyclonal 항체로, Western blot 및 IHC(P) 검증 완료. Human, Mouse, Rat 반응성. Lyophilized 형태로 제공되며, 항원 친화 크로마토그래피로 정제됨. 연구용으로만 사용 가능.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 02. 오후 06:02
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA579077 CK1 alpha Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원
Thermo Fisher Scientific · Thermo Fisher Scientific CK1 alpha Polyclonal Antibody
Applications
Western Blot (WB)
Immunohistochemistry (Paraffin) (IHC (P))
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the N-terminus of human CSNK1A1 (30–68aa DIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQ) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage conditions | -20°C |
| Shipping conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746193 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
CNSK1A1 (CK1 alpha 1)는 casein kinase I (CKI) 유전자 패밀리의 구성원으로, 산성 기질을 선호적으로 인산화하는 serine/threonine kinase를 암호화합니다. CKI 단백질은 단량체 형태로 25~55 kDa 범위에 있으며, 진핵세포의 핵, 세포질, 막 분획에 존재합니다.
이 단백질은 다수의 단백질을 인산화할 수 있으며, Wnt 신호전달에 관여합니다. CTNNB1을 Ser-45 위치에서 인산화하며, PER1과 PER2를 인산화할 가능성이 있습니다. 또한 유사분열 중 염색체 분리에 역할을 할 수 있습니다.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 없음)
Thermo Fisher Scientific 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.
