CacheBy
Thermo Fisher Scientific CK1 alpha Polyclonal Antibody
원본

Thermo Fisher Scientific CK1 alpha Polyclonal Antibody

상품 한눈에 보기

CK1 alpha 단백질을 인식하는 Rabbit Polyclonal 항체로, Western blot 및 IHC(P) 검증 완료. Human, Mouse, Rat 반응성. Lyophilized 형태로 제공되며, 항원 친화 크로마토그래피로 정제됨. 연구용으로만 사용 가능.

판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 02. 오후 06:02
Thermo Fisher Scientific PA579077 CK1 alpha Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원

Thermo Fisher Scientific · Thermo Fisher Scientific CK1 alpha Polyclonal Antibody

Applications

Western Blot (WB)

  • Tested Dilution: 0.1–0.5 µg/mL
  • Publications: -

Immunohistochemistry (Paraffin) (IHC (P))

  • Tested Dilution: 0.5–1 µg/mL
  • Publications: -

Product Specifications

항목 내용
Species Reactivity Human, Mouse, Rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human CSNK1A1 (30–68aa DIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQ)
Conjugate Unconjugated
Form Lyophilized
Concentration 500 µg/mL
Purification Antigen affinity chromatography
Storage buffer PBS with 5 mg BSA
Contains 0.05 mg sodium azide
Storage conditions -20°C
Shipping conditions Ambient (domestic); Wet ice (international)
RRID AB_2746193

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.


Target Information

CNSK1A1 (CK1 alpha 1)는 casein kinase I (CKI) 유전자 패밀리의 구성원으로, 산성 기질을 선호적으로 인산화하는 serine/threonine kinase를 암호화합니다. CKI 단백질은 단량체 형태로 25~55 kDa 범위에 있으며, 진핵세포의 핵, 세포질, 막 분획에 존재합니다.
이 단백질은 다수의 단백질을 인산화할 수 있으며, Wnt 신호전달에 관여합니다. CTNNB1을 Ser-45 위치에서 인산화하며, PER1과 PER2를 인산화할 가능성이 있습니다. 또한 유사분열 중 염색체 분리에 역할을 할 수 있습니다.


For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.


제품 이미지

(이미지 없음)

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.