Atlas Antibodies Anti-CASP3 Antibody

상품 한눈에 보기

Human CASP3 단백질을 인식하는 폴리클로날 항체로, apoptosis 관련 연구에 적합함. IHC, WB, ICC 등 다양한 응용 가능. Orthogonal validation으로 RNA-seq 데이터와 단백질 발현 비교 검증 완료. Rabbit 유래 IgG 항체, 고순도 affinity 정제 제품.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA002643-100 Anti-CASP3 Antibody, caspase 3, apoptosis-related cysteine peptidase 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA002643-25 Anti-CASP3 Antibody, caspase 3, apoptosis-related cysteine peptidase 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-CASP3 Antibody

Anti-CASP3 Antibody

Target: caspase 3 (apoptosis-related cysteine peptidase)
Supplier: Atlas Antibodies

Recommended Applications

IHC (Orthogonal validation)
WB (Western Blot)
ICC (Immunocytochemistry)

Orthogonal validation:
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human CASP3

Alternative Gene Names

apopain, CPP32, CPP32B, Yama

Open Datasheet

Specifications

항목	내용
Target Protein	caspase 3, apoptosis-related cysteine peptidase
Target Gene	CASP3
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	HGSESMDSGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDL
Verified Species Reactivity	Human
Interspecies Identity	Rat (88%), Mouse (84%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen
Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.
MSDS	Material Safety Data Sheet