Atlas Antibodies Anti-CASP2 Antibody

상품 한눈에 보기

Human CASP2를 인식하는 Rabbit Polyclonal Antibody로, apoptosis 관련 연구에 적합. IHC 및 ICC 응용에 권장되며, PrEST 항원으로 정제됨. 높은 종간 서열 유사성으로 인간, 마우스, 랫트에 반응.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA050678-100 Anti-CASP2 Antibody, caspase 2, apoptosis-related cysteine peptidase 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA050678-25 Anti-CASP2 Antibody, caspase 2, apoptosis-related cysteine peptidase 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: caspase 2, apoptosis-related cysteine peptidase
Supplier: Atlas Antibodies

Polyclonal Antibody against Human CASP2

ICH1, MGC2181, NEDD2, PPP1R57

Target Protein: caspase 2, apoptosis-related cysteine peptidase
Target Gene: CASP2
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

VELLNLLPKRGPQAFDAFCEALRETKQGHLEDMLLTTLSGLQHVLPPLSCDYDLSLPFPVCESCPLYKKLRLSTDTVEHSLDNKDGPVCLQVKPCTPEFYQTHFQLAYRLQSRPRGLALVLSNVHFTG

Human

Highest antigen sequence identity to the following orthologs:

Species	Gene ID	Sequence Identity
Mouse	ENSMUSG00000029863	87%
Rat	ENSRNOG00000016707	86%

Property	Description
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand