CacheBy
Atlas Antibodies Anti-CAPZA3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CAPZA3 Antibody

상품 한눈에 보기

인간 CAPZA3 단백질을 인식하는 폴리클로날 항체로, IHC 분석에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 토끼에서 생산된 IgG 형식입니다. RNA-seq 데이터 기반 정교한 단백질 발현 검증을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA038688-100 Anti-CAPZA3 Antibody, capping protein (actin filament) muscle Z-line, alpha 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038688-25 Anti-CAPZA3 Antibody, capping protein (actin filament) muscle Z-line, alpha 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CAPZA3 Antibody

Anti-CAPZA3 Antibody

Target: capping protein (actin filament) muscle Z-line, alpha 3
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal Antibody against Human CAPZA3


Alternative Gene Names

CAPPA3, Gsg3

Open Datasheet


Target Information

항목 내용
Target Protein capping protein (actin filament) muscle Z-line, alpha 3
Target Gene CAPZA3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000008727 (90%), Mouse ENSMUSG00000041791 (90%)

Antigen Sequence:
KDKERVIRRLLLQAPPGEFVNAFDDLCLLIRDEKLMHHQGECAGHQHCQKYSVPLCIDGNPVLLSHHNVMGDYRFFDHQSKLSFKYDLLQN


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.