CacheBy
Atlas Antibodies Anti-CAPZA2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CAPZA2 Antibody

상품 한눈에 보기

인간 CAPZA2 단백질에 특이적인 폴리클로날 항체로, IHC 및 WB에 적합합니다. 토끼 유래 IgG이며, PrEST 항원을 이용해 친화 정제되었습니다. 높은 종간 보존성을 가지며, CAPZ 복합체 연구에 유용합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA007643-100 Anti-CAPZA2 Antibody, capping protein (actin filament) muscle Z-line, alpha 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA007643-25 Anti-CAPZA2 Antibody, capping protein (actin filament) muscle Z-line, alpha 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CAPZA2 Antibody

Anti-CAPZA2 Antibody

Capping protein (actin filament) muscle Z-line, alpha 2


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human CAPZA2.


Alternative Gene Names

CAPPA2, CAPZ

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Capping protein (actin filament) muscle Z-line, alpha 2
Target Gene CAPZA2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence IEGYEDQVLITEHGDLGNGKFLDPKNRICFKFDHLRKEATDPRPCEVENAVESWRTSVETALRAYVKEHYPNGVCTVYGKKIDGQQTIIACIESHQFQA
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000015733 (96%)
Rat ENSRNOG00000056207 (96%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet (MSDS)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.