CacheBy
Atlas Antibodies Anti-CAPSL Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CAPSL Antibody

상품 한눈에 보기

인간 CAPSL 단백질을 인식하는 폴리클로날 항체로, IHC 등 단백질 발현 분석에 적합합니다. Rabbit 유래 IgG이며, PrEST 항원을 이용해 친화 정제되었습니다. Orthogonal validation으로 RNA-seq 데이터 기반 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA046811-100 Anti-CAPSL Antibody, calcyphosine-like 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA046811-25 Anti-CAPSL Antibody, calcyphosine-like 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CAPSL Antibody

Anti-CAPSL Antibody

Calcyphosine-like


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal Antibody against Human CAPSL


Alternative Gene Names

MGC26610

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Calcyphosine-like
Target Gene CAPSL
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence GIKGLGRVFRIMDDDNNRTLDFKEFMKGLNDYAVVMEKEEVEELFRRFDKDG
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000054277 (92%)
Mouse ENSMUSG00000039676 (90%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.