CacheBy
Atlas Antibodies Anti-CAPS2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CAPS2 Antibody

상품 한눈에 보기

인간 CAPS2 단백질을 표적으로 하는 폴리클로날 항체. 토끼 유래 IgG 형식으로 제작되어 높은 특이성과 재현성을 제공. PrEST 항원으로 친화 정제되어 다양한 연구 응용에 적합. 면역세포화학(ICC) 등 인체 시료 기반 분석에 권장. 안정화된 PBS 버퍼와 글리세롤 포함으로 장기 보관 용이.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA040004-100 Anti-CAPS2 Antibody, calcyphosine 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040004-25 Anti-CAPS2 Antibody, calcyphosine 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CAPS2 Antibody

Anti-CAPS2 Antibody

Target Information

  • Target Protein: Calcyphosine 2
  • Target Gene: CAPS2
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    LGSLVDSDDEDNFSYIPLSTANLPNSSSTLGWVTPCQTPYTQYHLNKLDQNIIPENLPAPTDKCKLKYQQCKTEIKEGYKQYSQRNAENTKSNVT
  • Verified Species Reactivity: Human
  • Interspecies Information:
    • Rat ENSRNOG00000026600 (57%)
    • Mouse ENSMUSG00000035694 (54%)

Product Description

Polyclonal Antibody against Human CAPS2

Open Datasheet

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Recommended Applications Immunocytochemistry (ICC)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.
  • Material Safety Data Sheet

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.