CacheBy
Atlas Antibodies Anti-CAMKK2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CAMKK2 Antibody

상품 한눈에 보기

인간 CAMKK2 단백질을 인식하는 고품질 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. 토끼 유래 IgG 항체로 PrEST 항원으로 정제됨. 인간에 대한 반응성이 검증됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA063713-100 Anti-CAMKK2 Antibody, calcium/calmodulin dependent protein kinase kinase 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA063713-25 Anti-CAMKK2 Antibody, calcium/calmodulin dependent protein kinase kinase 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CAMKK2 Antibody

Anti-CAMKK2 Antibody

Target: calcium/calmodulin-dependent protein kinase kinase 2, beta
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human CAMKK2.

Alternative Gene Names

CAMKK, CAMKKB, KIAA0787, MGC15254

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein calcium/calmodulin-dependent protein kinase kinase 2, beta
Target Gene CAMKK2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000001309 (81%), Mouse ENSMUSG00000029471 (77%)

Antigen Sequence:

SSCVSSQPSSNRAAPQDELGGRGSSSSESQKPCEALRGLSSLSIHLGMESFIVVTECEPGCAVDLGLARDRPLEADGQEVPLDTSGSQARPHLSGRKLSLQERSQGGLAAGGSLDMNGRCICPSLPYSPVSSPQSS

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.