Atlas Antibodies Anti-CAMKK1 Antibody

상품 한눈에 보기

Human CAMKK1 단백질을 인식하는 고품질 폴리클로날 항체. WB 및 ICC 실험에 적합하며, 재조합 발현 검증 완료. Rabbit 유래 IgG로 PrEST 항원 친화 정제. 높은 종간 반응 특이성과 안정적 보존용 버퍼 포함.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA028062-100 Anti-CAMKK1 Antibody, calcium/calmodulin-dependent protein kinase kinase 1, alpha 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA028062-25 Anti-CAMKK1 Antibody, calcium/calmodulin-dependent protein kinase kinase 1, alpha 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: calcium/calmodulin-dependent protein kinase kinase 1, alpha
Supplier: Atlas Antibodies

WB (Western Blot): Recombinant expression validation using target protein overexpression
ICC (Immunocytochemistry)

Polyclonal antibody against Human CAMKK1.

CAMKKA, DKFZp761M0423, MGC34095

항목	내용
Target Protein	calcium/calmodulin-dependent protein kinase kinase 1, alpha
Target Gene	CAMKK1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Rat (96%), Mouse (93%)

Antigen Sequence:
KSMLRKRSFGNPFEPQARREERSMSAPGNLLVKEGFGEGGKSPELPGVQEDEAAS

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS	Material Safety Data Sheet