
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CAMKK1 Antibody
상품 한눈에 보기
Human CAMKK1 단백질을 인식하는 고품질 폴리클로날 항체. WB 및 ICC 실험에 적합하며, 재조합 발현 검증 완료. Rabbit 유래 IgG로 PrEST 항원 친화 정제. 높은 종간 반응 특이성과 안정적 보존용 버퍼 포함.
- 카탈로그번호
- HPA028062-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA028062-100 Anti-CAMKK1 Antibody, calcium/calmodulin-dependent protein kinase kinase 1, alpha 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028062-25 Anti-CAMKK1 Antibody, calcium/calmodulin-dependent protein kinase kinase 1, alpha 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CAMKK1 Antibody
Anti-CAMKK1 Antibody
Target: calcium/calmodulin-dependent protein kinase kinase 1, alpha
Supplier: Atlas Antibodies
Recommended Applications
- WB (Western Blot): Recombinant expression validation using target protein overexpression
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against Human CAMKK1.
Alternative Gene Names
CAMKKA, DKFZp761M0423, MGC34095
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | calcium/calmodulin-dependent protein kinase kinase 1, alpha |
| Target Gene | CAMKK1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat (96%), Mouse (93%) |
Antigen Sequence:
KSMLRKRSFGNPFEPQARREERSMSAPGNLLVKEGFGEGGKSPELPGVQEDEAAS
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Datasheet
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



