CacheBy
Atlas Antibodies Anti-CALCA Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CALCA Antibody

상품 한눈에 보기

인간 CALCA 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 WB에 적합합니다. Rabbit에서 생산되었으며, PrEST 항원으로 정제되었습니다. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증된 고품질 항체입니다.

카탈로그번호
HPA064453-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA064453-100 Anti-CALCA Antibody, calcitonin related polypeptide alpha 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA064453-25 Anti-CALCA Antibody, calcitonin related polypeptide alpha 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CALCA Antibody

Anti-CALCA Antibody

calcitonin related polypeptide alpha

  • IHC (Orthogonal validation)
  • WB (Western Blot)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human CALCA

Alternative Gene Names

  • CALC1

Open Datasheet

Target Information

항목 내용
Target Protein calcitonin related polypeptide alpha
Target Gene CALCA
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Ortholog Identity Rat ENSRNOG00000011130 (81%), Mouse ENSMUSG00000030669 (78%)

Antigen Sequence:
SKRCGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAPGKKRDMSSDLERDHRPHVS

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
WB

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.